PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00023289001
Common NameGSBRNA2T00023289001, GSBRNA2T00023290001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 79aa    MW: 8655.4 Da    PI: 6.2121
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00023289001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.76.9e-15446246
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46
                         p lrWt++LH++Fv+a+e  G  e+AtPk++lel+  k Ltl+hv
  GSBRNA2T00023289001  4 PWLRWTTTLHACFVHAIELFGVLERATPKSVLELV--KYLTLAHV 46
                         569******************************96..56888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.24E-7346IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-12446IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-11646IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MTAPWLRWTT TLHACFVHAI ELFGVLERAT PKSVLELVKY LTLAHVLMSI CVTVAMSTPV  60
LTINSPDGDL IDCILLLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123613.12e-45PREDICTED: uncharacterized protein LOC103848466 isoform X1
RefseqXP_009123614.18e-46PREDICTED: uncharacterized protein LOC103848466 isoform X2
RefseqXP_013617646.15e-47PREDICTED: transcription repressor KAN1-like
SwissprotQ9C6161e-16KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A078J5K03e-50A0A078J5K0_BRANA; BnaAnng15020D protein
STRINGBra039528.1-P2e-38(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2349334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.18e-18G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]